PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01670.1.p
Common NameEUGRSUZ_K01670, LOC104425394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 302aa    MW: 32447.4 Da    PI: 6.9477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01670.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-30103156155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Eucgr.K01670.1.p 103 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 156
                       59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-20100160IPR009057Homeodomain-like
PROSITE profilePS5129411.059100159IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-30102161IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-24104156IPR006447Myb domain, plants
PfamPF002491.1E-7106155IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MREEDSNWFS KWEDELPSPD ELTPLSQTLI TPDLALAFDI PTPPHANPSP TSPPRHPPPT  60
PTNHSGHLPP PSSVTQPISA EFADSSELGP NSGGDEPART LKRPRLVWTP QLHKRFVDAV  120
AHLGIKNAVP KTIMQLMSVD GLTRENVASH LQKYRLYLKR MQGLSVGGGG GGGGGGGLAA  180
SSDPATDHLF ASSPVPAHFL HPVRPSSEHY LPFVPVALQH HQMAAAAGHP QLQPQYHRQV  240
GHFGPPPNGQ FEHPFLSRQA GPIHRMGAPI HNPVQPYVED LESANANGGR KVLTLFPTGD  300
D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-21102161463ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01670.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036386.10.0PREDICTED: transcription factor PCL1-like
TrEMBLA0A059A3P30.0A0A059A3P3_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s03340.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-98G2-like family protein